https://euroxanth.ipn.pt/ 2026-04-18T09:38:08+00:00 https://euroxanth.ipn.pt/ https://euroxanth.ipn.pt/_media/logo.png text/html 2025-07-04T22:05:04+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:avrbs1?rev=1751666704&do=diff The Type III Effector AvrBs1 from //Xanthomonas// Author: Mariya Stoyanova Internal reviewer: Yael Helman Class: AvrBs1 Family: AvrBs1 Prototype: AvrBs1 (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain E3) (Swanson text/html 2025-07-24T21:10:30+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:avrbs2?rev=1753391430&do=diff The Type III Effector AvrBs2 from //Xanthomonas// Author: Špela Alič Internal reviewer: Ralf Koebnik Class: AvrBs2 Protein family: AvrBs2 Prototype: AvrBs2 (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain 75-3) GenBank ID: text/html 2025-11-29T16:59:49+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:avrbs3?rev=1764435589&do=diff The Type III Effector AvrBs3 from //Xanthomonas// Author: Nay C Dia Internal reviewer: Jens Boch Expert reviewer: Sabine Thieme Class: AvrBs3 Family: Transcription Activator-Like (TAL) Effectors, TALEs (previously: AvrBs3/PthA) Prototype: AvrBs3 (Xanthomonas euvesicatoria pv. text/html 2025-04-24T08:36:29+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:effectors?rev=1745483789&do=diff Multi-FASTA-formatted list of type III effectors in amino acids - Last update 2023/10/03 >AvrBs1-WP_011037255.1 MSDMKVNFSSKIIDSTPSEEEVATQQDSYTKSGLVAPSLDSQALKKAPRKRVIKENIAALHTSSLERVHQ KKVLVQNLAQLQRGLAKINGRVELEELIDGFSVKELLIKRNPKIAEEYGEGNPLMIRSLRFSNPQEVTSK LGAEGKTPAKREVDTICNKSTLHDIVMTPASLVKKEVRMNLISEVPRAKDKQKYRGLPSVVYGQSSRRSE SDYLTSRNGFGDVHSFKSNNAFNSDYEKICGSLSHAEKLGLIERNLTPFIRHDPDRISTDFVHSIEELAE HQMLLQSRKPASALRHNEYCTKLELWDAKAIAVGESRALAVATLIEFNLEMLSIAQEIDDDGHKSKMVAD FIERQLSWLGPQTALDSKSTLERVSAVTIQER… text/html 2023-01-09T10:20:03+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:effector_reviews?rev=1673259603&do=diff Review papers on type III effectors * Arroyo-Velez N, González-Fuente M, Peeters N, Lauber E, Noël LD (2020). From effectors to effectomes: are functional studies of individual effectors enough to decipher plant pathogen infectious strategies? PLoS Pathog. 16: e1009059. DOI: text/html 2025-06-05T10:22:36+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:software?rev=1749118956&do=diff Software, Databases and Websites Based on discusisons during the International Type III Secretion Meeting in Tübingen (Germany) in April 2016, a unified nomenclature for injectisome-type type III secretion sytems was proposed in 2020 (Wagner & Diepold, 2020). This nomenclature was also advertised in the corresponding text/html 2026-03-18T14:42:41+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:t3e?rev=1773844961&do=diff Type III effectors from //Xanthomonas// Link to the original Xanthomonas //Resource @ xanthomonas.org Multi-FASTA-formatted list of type III effectors from Xanthomonas List of type III effectors in Xanthomonas (for download from NCBI) Pseudomonas–Plant Interaction website (Lindeberg et al., 2005) RalstoT3Edb (Peeters et al., 2013; Sabbagh et al., 2019) Review papers on type III effectors Software, databases and websites for type III effectors Empty template - Example 1: XopAU - Example 2… text/html 2025-07-13T22:26:46+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:t3e_template?rev=1752445606&do=diff The Type III Effector Xop? from //Xanthomonas// Author: John Doe Reviewer: Jane Doe Class: Xop? Family: Xop? Prototype: Xop? (Xanthomonas; strain) RefSeq ID: 3D structure: Biological function How discovered? (Experimental) evidence for being a T3E text/html 2025-07-13T22:57:33+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopaa?rev=1752447453&do=diff The Type III Effector XopAA from //Xanthomonas// Author: Ralf Koebnik Class: XopAA Family: XopAA Prototype: Ecf (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain 75-3) GenBank ID: AAW88576.1 (688 aa) RefSeq ID: WP_041855088.1 (688 aa) text/html 2025-07-28T14:18:13+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopab?rev=1753712293&do=diff The Type III Effector XopAB from //Xanthomonas// Author: Ralf Koebnik Class: XopAB Family: XopAB Prototype: XOO3150 (Xanthomonas oryzae pv. oryzae; strain T7174) GenBank ID: BAE69905.1 (193 aa) RefSeq ID: WP_011409110.1 (193 aa) 3D structure: Unknown Biological function How discovered? text/html 2025-07-24T21:20:23+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopac?rev=1753392023&do=diff The Type III Effector XopAC from //Xanthomonas// Author: Laurent D. Noël Internal reviewer: Ralf Koebnik Expert reviewer: Jian-Min Zhou Class: XopAC Family: XopAC Prototype: XopAC (Xanthomonas campestris pv. campestris; strain 8004) GenBank ID: AFP74845.1 (536 aa) RefSeq ID: WP_011269629.1 (536 aa) 3D structure: Unknown text/html 2025-11-15T13:44:25+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopad?rev=1763214265&do=diff The Type III Effector XopAD from //Xanthomonas// Author: David J. Studholme Internal reviewer: Laurent D. Noël Class: XopAD Family: XopAD Prototypes: XAC4213 (Xanthomonas citri pv. citri; strain 306), XOO4145 (Xanthomonas oryzae pv. oryzae; strain T7174) GenBank ID (XAC4213): text/html 2025-07-24T21:24:16+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopae?rev=1753392256&do=diff The Type III Effector XopAE from //Xanthomonas// Author: Guido Sessa Internal reviewers: David J. Studholme, Ralf Koebnik Expert reviewer: Laurent D. Noël Class: XopAE Family: XopAE Prototype: HpaF/HpaG (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain 85-10) text/html 2025-07-04T22:11:13+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopaf?rev=1751667073&do=diff The Type III Effector XopAF from //Xanthomonas// Author: Tamás Kovács Internal reviewer: Guido Sessa Class: XopAF Families: XopAF1, XopAF2 Prototype: AvrXv3 (Xanthomonas euvesicatoria pv. perforans; strain T3) GenBank ID (XopAF1): AAG18480.1 (218 aa) RefSeq ID (XopAF1): WP_008577605.1 (218 aa) text/html 2025-07-24T21:24:44+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopag?rev=1753392284&do=diff The Type III Effector XopAG from //Xanthomonas// Author: Christian Vernière & Trainees from the 2nd EuroXanth Training School (Songül Erken, Damla Ertimurtaş, Jelena Menković, Andjelka Prokić) Internal reviewer: Tamás Kovács Expert reviewer: Nian Wang Class: XopAG Families: XopAG1, XopAG2 Prototype: AvrGf1 (Xanthomonas citri pv. citri; Xac‐A text/html 2025-11-29T17:45:34+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopah?rev=1764438334&do=diff The Type III Effector XopAH from //Xanthomonas// Author: Steven J Roberts Internal reviewer: Christian Vernière, Anna Passelergue Expert reviewer: Ralf Koebnik Class: XopAH Family: XopAH Prototype: AvrXccC (Xanthomonas campestris pv. campestris; strain 8004) GenBank ID: ABQ10636.1 (440 aa) RefSeq ID: text/html 2025-07-24T22:20:04+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopai?rev=1753395604&do=diff The Type III Effector XopAI from //Xanthomonas// Author: Ralf Koebnik Class: XopAI Family: XopAI Prototype: XAC3230 (Xanthomonas citri pv. citri; strain 306) GenBank ID: AAM38074.1 (296 aa) RefSeq ID: WP_011052119.1 (296 aa) 3D structure: 6K93, 6K94, 6KLY (Liu et al., 2019) Biological function text/html 2025-11-29T17:20:03+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopaj?rev=1764436803&do=diff The Type III Effector XopAJ from //Xanthomonas// Authors: Ralf Koebnik & Trainees from the 2nd EuroXanth Training School (Daiva Burokienė, Edyta Đermić, Dagmar Stehlikova, Mariya Stoyanova) Internal reviewer: Joël F Pothier Expert reviewer: Lindsay Triplett Class: XopAJ Family: XopAJ Prototype: AvrRxo1 (Xanthomonas oryzae pv. oryzicola; strain BLS256) text/html 2025-07-04T22:16:00+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopak?rev=1751667360&do=diff The Type III Effector XopAK from //Xanthomonas// Author: Vittoria Catara Internal reviewer: Ralf Koebnik Expert reviewer: Guido Sessa, Xinhua Ding Class: XopAK Family: XopAK Prototype: XCV3786 (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain 85-10) text/html 2025-11-15T13:46:08+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopal1?rev=1763214368&do=diff The Type III Effector XopAL1 from //Xanthomonas// Author: Matthieu Arlat Internal reviewer: Joana Costa, Anna Passelergue Expert reviewer: Ralf Koebnik Class: XopAL Family: XopAL1 Prototype: XC_2995/XopXccE1 (Xanthomonas campestris pv. campestris; strain 8004) (Jiang et al., 2009) text/html 2025-07-04T22:17:09+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopal2?rev=1751667429&do=diff The Type III Effector XopAL2 from //Xanthomonas// Author: Matthieu Arlat Internal reviewer: Ralf Koebnik Class: XopAL Family: XopAL2 Prototype: XopAL2 (Xanthomonas campestris pv. campestris; strain B100) (Vorhölter et al., 2008) GenBank ID: CAP49952.1 (293 aa) RefSeq ID: WP_012437264.1 (293 aa) text/html 2025-07-04T22:19:10+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopam?rev=1751667550&do=diff The Type III Effector XopAM from //Xanthomonas// Author: Ralf Koebnik Class: XopAM Family: XopAM Prototype: XopXccR1/XC_3160 (Xanthomonas campestris pv. campestris; strain 8004) (Jiang et al., 2009) GenBank ID: AAY50204.1 (2031 aa) RefSeq ID: WP_012438997.1 (2049 aa) 3D structure: Unknown text/html 2025-07-04T22:19:30+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopan?rev=1751667570&do=diff The Type III Effector XopAN from //Xanthomonas// (replaced by XopAV) Author: Ralf Koebnik Class: XopAN Family: XopAN Prototype: XopAN (Xanthomonas campestris pv. campestris) 3D structure: Unknown Biological function How discovered? XopAN was originally reserved for a type 3 effector from text/html 2025-11-24T14:01:57+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopao?rev=1763992917&do=diff The Type III Effector XopAO from //Xanthomonas// Author: Ralf Koebnik Class: XopAO Family: XopAO Prototype: XGA_1250 (Xanthomonas hortorum pv. gardneri, ex. Xanthomonas gardneri; strain 101 = ATCC 19865) GenBank ID: EGD20072.1 (206 aa) RefSeq ID: WP_162267513.1 (207 aa) 3D structure: Unknown text/html 2025-11-29T21:57:30+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopap?rev=1764453450&do=diff The Type III Effector XopAP from //Xanthomonas// Author: Saul Burdman Internal reviewer: Joël F Pothier Expert reviewer: Doron Teper Class: XopAP Family: XopAP Prototype: XPE_1567 (Xanthomonas euvesicatoria pv. perforans; strain 91- 118) and XCV3138 (Xanthomonas euvesicatoria pv. text/html 2025-11-14T16:06:05+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopaq?rev=1763136365&do=diff The Type III Effector XopAQ from //Xanthomonas// Author: Jose Gadea Internal reviewer: Saul Burdman Class: XopAQ Family: XopAQ Prototype: XGA_2091 (Xanthomonas hortorum pv. gardneri, ex. Xanthomonas gardneri; strain 101 = ATCC 19865) GenBank ID: EGD19295.1 (95 aa) RefSeq ID: text/html 2025-11-05T17:39:02+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopar?rev=1762364342&do=diff The Type III Effector XopAR from //Xanthomonas// Author: Ralf Koebnik Class: XopAR Family: XopAR Prototype: XVE_3216 (Xanthomonas vesicatoria; strain 1111 = ATCC 35937) GenBank ID: EGD08505.1 (132 aa) RefSeq ID: Not available 3D structure: Unknown Biological function text/html 2025-11-05T17:39:31+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopas?rev=1762364371&do=diff The Type III Effector XopAS from //Xanthomonas// Author: Ralf Koebnik Class: XopAS Family: XopAS Prototype: XGA_0764/0765 (Xanthomonas hortorum pv. gardneri, ex. Xanthomonas gardneri; strain 101 = ATCC 19865) GenBank ID (XGA_0764): EGD20560.1 (601 aa) GenBank ID (XGA_0765): text/html 2025-11-05T17:39:50+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopat?rev=1762364390&do=diff The Type III Effector XopAT from //Xanthomonas// Author: Ralf Koebnik Class: XopAT Family: XopAT Prototype: XCR_1464a (Xanthomonas campestris pv. raphani; strain 756C) GenBank ID: AEL06363.1 (211 aa) RefSeq ID: WP_148263049.1 (155 aa, probably too short) 3D structure: Unknown Biological function text/html 2025-11-26T10:49:05+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopau?rev=1764154145&do=diff The Type III Effector XopAU from //Xanthomonas// Author: Eran Bosis Internal reviewer: Jose Gadea Expert reviewer: Doron Teper Class: XopAU Family: XopAU Prototype: XCV1196 (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vescicatoria; strain 85-10) text/html 2025-11-05T17:40:19+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopav?rev=1762364419&do=diff The Type III Effector XopAV from //Xanthomonas// Author: Ralf Koebnik Class: XopAV Families: XopAV1, XopAV2 Prototypes: XCV1197/XCV1198 (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vescicatoria; strain 85-10) (Teper et al., 2016) and XC_3176 ( text/html 2025-07-04T22:20:19+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopaw?rev=1751667619&do=diff The Type III Effector XopAW from //Xanthomonas// Author: Yael Helman Internal reviewer: Monika Kałużna Expert reviewer: Ralf Koebnik Class: XopAW Family: XopAW Prototype: XCV3093 (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain 85-10) text/html 2025-07-04T22:20:57+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopax?rev=1751667657&do=diff The Type III Effector XopAX from //Xanthomonas// Author: Doron Teper Class: XopAX Family: XopAX Prototype: XCVd0086 (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain 85-10) GenBank ID: CAJ19898.1 (383 aa) RefSeq ID: WP_041854960.1 (353 aa) text/html 2025-07-04T22:21:35+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopay?rev=1751667695&do=diff The Type III Effector XopAY from //Xanthomonas// (replaced by XopAV) Author: Ralf Koebnik Class: XopAY Family: XopAY Prototype: XC_3176 (Xanthomonas campestris pv. campestris; strain 8004) GenBank ID: AAY50220.1 (244 aa) 3D structure: Unknown Biological function How discovered? text/html 2025-07-04T22:22:08+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopaz?rev=1751667728&do=diff The Type III Effector XopAZ from //Xanthomonas// Author: Ralf Koebnik Class: XopAZ Family: XopAZ Prototype: XopAZ (Xanthomonas hortorum pv. cynarae, formerly Xanthomonas cynarae; strain CFBP 4188) (Kara, 2016) GenBank ID: MCE4349711.1 (157 aa) RefSeq ID: WP_104549896.1 (157 aa) 3D structure: Unknown text/html 2025-07-04T22:22:54+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopb?rev=1751667774&do=diff The Type III Effector XopB from //Xanthomonas// Author: Ralf Koebnik Internal reviewer: Nay C. Dia Class: XopB Family: XopB Prototype: XCV0581 (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain 85-10) GenBank ID: CAJ22212.1 (613 aa) text/html 2026-03-11T13:59:34+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopba?rev=1773237574&do=diff The Type III Effector XopBA from //Xanthomonas// Author: Ralf Koebnik Internal reviewer: Anna Passelergue Class: XopBA Family: XopBA Prototype: XopBAXee66b (Xanthomonas euvesicatoria pv. euvesicatoria; strain 66b) RefSeq ID: WP_227478587.1 (500 aa) 3D structure: Unknown text/html 2025-07-04T22:26:12+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopbb?rev=1751667972&do=diff The Type III Effector XopBB from //Xanthomonas// Author: Ralf Koebnik Class: XopBB Family: XopBB Prototype: ELAGFFLI_02299 (Xanthomonas hortorum pv. pelargonii; strain 305) GenBank ID: CAD0333498 (332 aa) RefSeq ID: WP_251761698.1 (220 aa, corresponding to the C-terminal domain) text/html 2025-07-04T22:26:27+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopbg?rev=1751667987&do=diff The Type III Effector XopBG from //Xanthomonas// Author: Ralf Koebnik Class: XopBG Family: XopBG Prototype: BER92_RS22150 (Xanthomonas fragariae; strain Fap21) RefSeq ID: WP_145953988.1 (158 aa) 3D structure: Unknown Biological function How discovered? XopBG was discovered using a machine-learning approach for the prediction of T3Es (Wagner text/html 2025-11-15T14:10:12+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopbh?rev=1763215812&do=diff The Type III Effector XopBH from //Xanthomonas// Author: Naama Wagner Internal reviewer: Leonor Martins Expert reviewer: Ralf Koebnik Class: XopBH Family: XopBH Prototype: XTG_RS02340 (Xanthomonas euroxanthea, strain CPBF 424). Attention: The prototype sequence is too long because codons 18 to 39 overlap with the plant-inducible promoter (see below; Koebnik text/html 2025-12-18T09:52:13+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopc?rev=1766051533&do=diff The Type III Effector XopC from //Xanthomonas// Author: Alice Boulanger Internal reviewer: Ralf Koebnik Class: XopC Families: XopC1 and XopC2 Prototype (XopC1): XCV2435 (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain 85-10) text/html 2025-07-04T22:29:09+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopd?rev=1751668149&do=diff The Type III Effector XopD from //Xanthomonas// Author: Monika Kałużna Internal reviewer: Alice Boulanger Class: XopD (Xanthomonas outer protein D) Family: XopD Prototype: XCV0437 (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain 85-10) text/html 2025-07-04T22:29:51+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xope1?rev=1751668191&do=diff The Type III Effector XopE1 from //Xanthomonas// Author: Jaime Cubero Internal reviewer: Ralf Koebnik Class: XopE Family: XopE1 Prototype: XCV0294 (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain 85-10) GenBank ID: CAJ21925.1 (400 aa) text/html 2025-07-04T22:30:39+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xope2?rev=1751668239&do=diff The Type III Effector XopE2 from //Xanthomonas// Author: Jaime Cubero Internal reviewer: Eran Bosis Expert reviewer: Ralf Koebnik Class: XopE Family: XopE2 Prototype: XCV2280 (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain 85-10) text/html 2025-07-04T22:31:28+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xope3?rev=1751668288&do=diff The Type III Effector XopE3 from //Xanthomonas// Author: Jaime Cubero Internal reviewer: Eran Bosis Expert reviewer: João C. Setubal Class: XopE Family: XopE3 Prototype: XAC3224 (Xanthomonas citri pv. citri; strain 306) GenBank ID: AAM38068.1 (356 aa) RefSeq ID: WP_011052114.1 (356 aa) Synonym: AvrXacE2 ( text/html 2025-07-24T21:28:42+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xope4?rev=1753392522&do=diff The Type III Effector XopE4 from //Xanthomonas// Author: Jaime Cubero Internal reviewer: Eran Bosis Expert reviewer: Adriana Bernal Class: XopE Family: XopE4 Prototype: XAUC_31730 (Xanthomonas fuscans pv. aurantifolii) GenBank ID: EFF46466.1 (388 aa - likely too long) RefSeq ID: WP_244170787.1 (367 aa) text/html 2025-07-04T22:32:46+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xope5?rev=1751668366&do=diff The Type III Effector XopE5 from //Xanthomonas// Author: Jaime Cubero Internal reviewer: Eran Bosis Class: XopE Family: XopE5 Prototype: (Xanthomonas translucens) RefSeq ID: WP_260607984.1 3D structure: Unknown Biological function How discovered? XopE5 (HopX1) was first identified by sequence homology searches (Peng text/html 2025-07-24T21:31:42+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopf?rev=1753392702&do=diff The Type III Effector XopF from //Xanthomonas// Author: Leonor Martins Internal reviewer: Jaime Cubero Expert reviewer: Kalyan K Mondal Class: XopF Families: XopF1, XopF2, XopF3 Prototype: XCV0414 (XopF1) (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria text/html 2025-07-04T22:34:12+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopg?rev=1751668452&do=diff The Type III Effector XopG from //Xanthomonas// Author: Camila Fernandes Internal reviewer: Leonor Martins Expert reviewer: Neha Potnis Class: XopG Families: XopG1, XopG2, XopG3 Prototype: XCV1298 (XopG1) (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria text/html 2025-07-04T22:34:53+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xoph?rev=1751668493&do=diff The Type III Effector XopH from //Xanthomonas// Author: Isabel Rodrigues Internal reviewer: Camila Fernandes Class: XopH Families: XopH1, XopH2 Prototype: AvrBs1.1 (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain E3) (Ronald and Staskawicz, 1988) text/html 2025-07-24T21:32:34+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopi?rev=1753392754&do=diff The Type III Effector XopI from //Xanthomonas// Author: Joana Costa & Trainees from the 2nd EuroXanth Training School (Maria Laura Destefanis, Katarina Gašić, Grazia Licciardello, Tamara Popović) Internal reviewer: Isabel Rodrigues Class: XopI Families: XopI1, XopI2 Prototype: XCV0806 (Xanthomonas euvesicatoria text/html 2025-07-04T22:36:26+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopj1?rev=1751668586&do=diff The Type III Effector XopJ1 from //Xanthomonas// Author: Jens Boch Internal reviewer: Joana Costa Expert reviewer: Frederik Börnke Class: XopJ Family: XopJ1 Prototype: XCV2156 (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain 85-10) text/html 2025-07-04T22:37:01+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopj2?rev=1751668621&do=diff The Type III Effector XopJ2 from //Xanthomonas// Author: Daiva Burokienė Internal reviewer: Eran Bosis Expert reviewer: Ralf Koebnik Class: XopJ Family: XopJ2 Prototype: AvrBsT (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain 75-3) GenBank ID: text/html 2025-07-24T21:33:53+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopj3?rev=1753392833&do=diff The Type III Effector XopJ3 from //Xanthomonas// Author: Doron Teper Class: XopJ Family: XopJ3 Prototype: AvrRxv (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain 75-3) GenBank ID: AAA27595.1 (373 aa) RefSeq ID: WP_011346137.1 (373 aa) text/html 2025-07-24T21:36:21+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopj4?rev=1753392981&do=diff The Type III Effector XopJ4 from //Xanthomonas// Author: Katarina Gašić Internal reviewer: Daiva Burokienė Class: XopJ Family: XopJ4 Prototype: AvrXv4 (Xanthomonas euvesicatoria pv. perforans, ex Xanthomonas campestris pv. vesicatoria; race T3 strain 91-118) GenBank ID: AAG39033.1 (359 aa) text/html 2025-07-04T22:38:52+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopj5?rev=1751668732&do=diff The Type III Effector XopJ5 from //Xanthomonas// Author: Alexandre B. de Menezes Internal reviewer: Katarina Gašić Class: XopJ Family: XopJ5 Prototype: AvrXccB (Xanthomonas campestris pv. campestris; strain ATCC 33913) GenBank ID: AAM42989.1 (235 aa) RefSeq ID: WP_228442257.1 (360 aa) Synonym: AvrXccB text/html 2025-11-24T14:09:45+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopj6?rev=1763993385&do=diff The Type III Effector XopJ6 from //Xanthomonas// Author: Laurent D Noël Internal reviewer: Ralf Koebnik Class: XopJ Family: XopJ6 Prototype: XopJ6 (Xanthomonas campestris pv. campestris; strain CN06) RefSeq ID: WP_196765268.1 (471 aa) 3D structure: Unknown Biological function How discovered? text/html 2025-07-24T22:28:58+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopj7?rev=1753396138&do=diff The Type III Effector XopJ7 from //Xanthomonas// Author: Anna Passelergue Internal reviewer: Ralf Koebnik Class: XopJ Family: XopJ7 Prototype: E4A48_06420 (Xanthomonas cerealis pv. cerealis, strain 01) GenBank ID: QDI05802.1 (493 aa) RefSeq ID: WP_185910725.1 (389 aa). Attention: The RefSeq sequence is too short because 104 codons encoding the N-terminal region, including the type III secretion signal, are missing. text/html 2025-07-24T22:30:33+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopj8?rev=1753396233&do=diff The Type III Effector XopJ8 from //Xanthomonas// Author: Anna Passelergue Internal reviewer: Ralf Koebnik Class: XopJ Family: XopJ8 Prototype: FZ025_RS03100 (Xanthomonas hyacinthi, strain CFBP 1156) GenBank ID: QGY75705.1 (362 aa) RefSeq ID: WP_104559054.1 (362 aa). 3D structure: Unknown text/html 2025-11-29T17:32:13+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopk?rev=1764437533&do=diff The Type III Effector XopK from //Xanthomonas// Author: Joël F Pothier & Trainees from the 2nd EuroXanth Training School (Amandine Cunty, Filip Gazdik, Leonor Martins, Cinzia Van Malderghem, Esther Van Veen) Internal reviewer: Alexandre B de Menezes Expert reviewer: Rebecca Bart Class: XopK Family: XopK Prototype: XOO1669 (Xanthomonas oryzae pv. oryzae text/html 2025-12-12T10:12:12+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopl?rev=1765534332&do=diff The Type III Effector XopL from //Xanthomonas// Author: Joana G Vicente Internal reviewer: Joël F Pothier Expert reviewer: Jessica L Erickson Class: XopL Family: XopL Prototype: XCV3220 (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain 85-10) GenBank ID: text/html 2025-07-04T22:42:11+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopm?rev=1751668931&do=diff The Type III Effector XopM from //Xanthomonas// Author: Ralf Koebnik Expert reviewer: Frederik Börnke Class: XopM Family: XopM Prototype: XCV0442 (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain 85-10) RefSeq ID: WP_011346113.1 3D structure: Unknown text/html 2025-12-11T12:25:11+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopn?rev=1765455911&do=diff The Type III Effector XopN from //Xanthomonas// Author: Jakub Pečenka Internal reviewer: Joana G Vicente Class: XopN Family: XopN Prototype: XopN (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain 85-10) GenBank ID: AAV74202.1 (733 aa) text/html 2025-11-24T14:22:06+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopo?rev=1763994126&do=diff The Type III Effector XopO from //Xanthomonas// Author: Harrold van den Burg Internal reviewer: Jakub Pečenka Expert reviewer: Zoe Dubrow Class: XopO Family: XopO Prototype: XopO (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain 85-10) GenBank ID: text/html 2025-11-15T14:15:32+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopp?rev=1763216132&do=diff The Type III Effector XopP from //Xanthomonas// Author: Claude Bragard Internal reviewer: Harrold van den Burg Class: XopP Family: XopP Prototype: XopP (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain 85-10) GenBank ID: AAV74208.1 (658 aa) text/html 2025-11-24T14:24:47+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopq?rev=1763994287&do=diff The Type III Effector XopQ from //Xanthomonas// Author: Valérie Olivier, Tamara Popović Internal reviewer: Ralf Koebnik Class: XopQ Family: XopQ Prototype: XopQ (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain 85-10) GenBank ID: text/html 2025-11-29T16:54:40+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopr?rev=1764435280&do=diff The Type III Effector XopR from //Xanthomonas// Author: Fernando Tavares Internal reviewer: Amandine Cunty Class: XopR Family: XopR Prototype: XOO4134 (Xanthomonas oryzae pv. oryzae; strain T7174R) GenBank ID: BAE70889.1 (437 aa) RefSeq ID: XopR WP_011260681.1 (437 aa) 3D structure: Unknown Biological function text/html 2025-07-24T22:21:23+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xops?rev=1753395683&do=diff The Type III Effector XopS from //Xanthomonas// Author: Gábor Rákheli Internal reviewer: Fernando Tavares Expert reviewer: Sujan Timilsina Class: XopS Family: XopS Prototype: XCV0324 (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain 85-10) GenBank ID: text/html 2025-07-04T22:46:28+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopt?rev=1751669188&do=diff The Type III Effector XopT from //Xanthomonas// Author: Ralf Koebnik Class: XopT Family: XopT Prototype: XOO2210 (Xanthomonas oryzae pv. oryzae; strain T7174) GenBank ID: BAE68965.1 (293 aa) RefSeq ID: WP_199285673.1 (344 aa) 3D structure: Unknown Biological function How discovered? text/html 2025-07-04T22:46:52+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopu?rev=1751669212&do=diff The Type III Effector XopU from //Xanthomonas// Author: Ralf Koebnik Class: XopU Family: XopU Prototype: XOO2877 (Xanthomonas oryzae pv. oryzae; strain T7174) GenBank ID: BAE69632.1 (985 aa) RefSeq ID: WP_011408937.1 (985 aa) 3D structure: Unknown Biological function How discovered? text/html 2025-11-15T14:18:22+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopv?rev=1763216302&do=diff The Type III Effector XopV from //Xanthomonas// Author: Coline Sciallano Internal reviewer: Gábor Rákheli Expert reviewer: Seiji Tsuge Class: XopV Family: XopV Prototype: XOO3803 (Xanthomonas oryzae pv. oryzae; strain T7174) GenBank ID: BAE70558.1 (331 aa) RefSeq ID: WP_011409498.1 (331 aa) 3D structure: Unknown text/html 2025-11-24T14:03:51+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopw?rev=1763993031&do=diff The Type III Effector XopW from //Xanthomonas// Author: Ralf Koebnik Internal reviewer: Anna Passelergue Class: XopW Families: XopW1, XopW2, XopW3, XopW4, XopW5 Prototype: XOO0037 (XopW1) (Xanthomonas oryzae pv. oryzae; strain T7174), G4Q83_RS22690 (XopW2) ( text/html 2025-11-29T17:52:06+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopx?rev=1764438726&do=diff The Type III Effector XopX from //Xanthomonas// Author: Lucas Morinière & Sohini Deb Internal reviewer: Coline Sciallano Expert reviewer: Ramesh V Sonti Class: XopX Family: XopX Prototype: XopX (Xanthomonas euvesicatoria pv. euvesicatoria, ex Xanthomonas campestris pv. vesicatoria; strain GM98-3) text/html 2025-07-04T22:48:58+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopy?rev=1751669338&do=diff The Type III Effector XopY from //Xanthomonas// Author: Irena Mačionienė Internal reviewer: Lucas Morinière Class: XopY Family: XopY Prototype: XOO1488 (Xanthomonas oryzae pv. oryzae; strain T7174) GenBank ID: BAE68243.1 (281 aa) RefSeq ID: WP_011408080.1 (281 aa) 3D structure: Unknown Biological function text/html 2025-11-29T21:54:51+00:00 Anonymous (anonymous@undisclosed.example.com) https://euroxanth.ipn.pt/bacteria:t3e:xopz?rev=1764453291&do=diff The Type III Effector XopZ from //Xanthomonas// Author: Marlène Lachaux Internal reviewer: Joël F Pothier Class: XopZ Families: XopZ1, XopZ2 Prototype: XOO2402 (Xanthomonas oryzae pv. oryzae; strain T7174) GenBank ID (XopZ1): BAE69157.1 (1288 aa) GenBank ID (XopZ2): EGD08510.1 (1265 aa) RefSeq ID (XopZ1):