Differences

This shows you the differences between two versions of the page.

--- bacteria:t3e:xopay [2023/02/16 14:43] – [Conservation] rkoebnik
+++ bacteria:t3e:xopay [2024/12/16 14:50] (current) – [The Type III Effector XopAY from //Xanthomonas// (replaced by XopAV)] rkoebnik
@@ Line 1: / Line 1: @@
-====== XopAY ======
+====== The Type III Effector XopAY from //Xanthomonas// (replaced by XopAV) ======
-Author: [[https://www.researchgate.net/profile/Ralf-Koebnik|Ralf Koebnik]]\\
+Author: [[https://www.researchgate.net/profile/Ralf-Koebnik|Ralf Koebnik]]
-Internal reviewer:\\
-Expert reviewer
 Class: XopAY\\
 Family: XopAY\\
-Prototype: XopAY (//Xanthomonas hortorum// pv. //cynarae//, formerly //Xanthomonas cynarae//; strain CFBP 4188) (Kara, 2016)\\
+Prototype: XC_3176 (//Xanthomonas campestris// pv. //campestris//; strain 8004)\\
-RefSeq ID: [[https://www.ncbi.nlm.nih.gov/protein/WP_104549896.1|WP_104549896.1]] (157 aa)\\
+GenBank ID: [[https://www.ncbi.nlm.nih.gov/protein/AAY50220.1|AAY50220.1]] (244 aa)\\
 D structure: Unknown
@@ Line 14: / Line 12: @@
 === How discovered? ===
+XopAY was originally assigned to [[https://www.ncbi.nlm.nih.gov/protein/AAY50220.1|XC_3176]], a protein that was identified as a type 3 effector (see below; Yang //et al.//, 2015). The N-terminal portion of [[https://www.ncbi.nlm.nih.gov/protein/AAY50220.1|XC_3176]] is similar to [[https://www.ncbi.nlm.nih.gov/protein/CAJ22828.1|XCV1197]] and the C-terminal portion is similar to [[https://www.ncbi.nlm.nih.gov/protein/CAJ22829.1|XCV1198]]. [[https://www.ncbi.nlm.nih.gov/protein/CAJ22828.1|XCV1197]] was shown to contain a type 3 secretion signal and was called [[:bacteria:t3e:xopav|XopAV]], now classified as XopAV1 (Teper //et al.//, 2016 ), whereas [[https://www.ncbi.nlm.nih.gov/protein/AAY50220.1|XC_3176]] was classified as XopAV2.
+<code>
+XopAV1          ------------------------------------------------------------
+XCV1197         MRREQCTKQCRRGRSCAGAACLGRWRGGIGAGCGGQRARSTRSPATLLVCLQRYVARACT
+XCV1198         ------------------------------------------------------------
+XC_3176         ------------------------------------------------------------
+XopAV2          ------------------------------------------------------------
+XopAV1          -------------------------------MARIHSGEVTMRPLALTSVTRRGARREQQ
+XCV1197         ACALWQAPCRLFRVRQWFFGRMRHARSRWGTMARIHSGEVTMRPLALTSVTRRGARREQQ
+XCV1198         ------------------------------------------------------------
+XC_3176         ----------------------------------------------MTSVAREAVRHDQR
+XopAV2          -----------------------------------------MGSFPVTSVAREAVRHDQR
+XopAV1          EGATVADAGPPAPANDPHANTQLAQSLPRRPVREARLRAPGTPRGVPLVNLGRTMAHLGA
+XCV1197         EGATVADAGPPAPANDPHANTQLAQSLPRRPTAISTMTCITRILL---------------
+XCV1198         ------------------------------------------------------------
+XC_3176         EAQAPREVGYSSQRGDPQANPQLKQDLSRAPVRAARLKAPRVPIGVHIANTGLQAARFAT
+XopAV2          EAQAPREVGYSSQRGDPQANPQLKQDLSRAPVRAARLKAPRVPIGVHIANTGLQAARFAT
+XopAV1          ---VGAAVWGGFAAIQAPAAAAYGYFNDDLYYKNLAVVSGYQAVGALAAFLGMGLADVLA
+XCV1197         ------------------------------------------------------------
+XCV1198         -------------------------------------------MGALAAFLGMGLADVLA
+XC_3176         SAVAGPAEAAVLDAVHAPAAAAYDYAKGEVSWKKNAGVTLAPALAYAVVMGTLSAVQYLA
+XopAV2          SAVAGPAEAAVLDAVHAPAAAAYDYAKGEVSWKKNAGVTLAPALAYAVVMGTLSAVQYLA
+XopAV1          ARYVEAQSRWYEVPTKAQRASELGATEACLDQAVDMVTRLDADPPGPGMDEGERLALARD
+XCV1197         ------------------------------------------------------------
+XCV1198         ARYVEAQSRWYEVPTKAQRASELGATEACLDHAVDMVTIFDADHPGPAMDGGEQLVLATD
+XC_3176         NRYLQAQSQ--TSVSKADRAKELGVTEACLDAAAAMVNKGEVAGPGGEMTEEEAAALAAD
+XopAV2          NRYLQAQSQ--TSVSKADRAKELGVTEACLDAAAAMVNKGEVAGPGGEMTEEEAAALAAD
+XopAV1          LMHLMTVERSRLPPDLWRAARGAGNDAYGLVARLLQAARARAAEEASTSSAG
+XCV1197         ----------------------------------------------------
+XCV1198         LLHLMTVERSRLPPELWQAASGVGDDAHRLVTQLLQAARARAADEASTSSAD
+XC_3176         LQNLATADRSRLPPELWRAASGVGDDAYALVTQLLLAARARASAEASASSDG
+XopAV2          LQNLATADRSRLPPELWRAASGVGDDAYALVTQLLLAARARASAEASASSDG
+</code>
 === (Experimental) evidence for being a T3E ===
+The promoter and signal region of XC_3176 were fused to the HR-inducing AvrBs1 C-terminal domain lack of 58 N-terminal amino acid residues. This construct elicited an hypersensitive response on the pepper ECW-10R containing the corresponding resistance gene //Bs1// in a //hrcV//-dependent manner (Yang et al., 2015).
 === Regulation ===
+A reporter GUS fusion of XC_3176 displayed GUS activities, which were significantly lower in the mutant strains Δ//hrpX// and Δ//hrpG// than that in the wild type //X. campestris// pv. //campestris// strain (Yang et al., 2015).
 === Phenotypes ===
+XC_3176 was found to be required for the full virulence of //X. campestris// pv. //campestris// strain 8004 when assayed on Chinese radish by the leaf-clipping method (Yang et al., 2015).
 === Localization ===
+Unknown
 === Enzymatic function ===
-Predicted peptidylprolyl isomerase.
+Unknown
 === Interaction partners ===
+Unknown
 ===== Conservation =====
@@ Line 33: / Line 79: @@
 === In xanthomonads ===
-Universally conserved protein.
+Yes (e.g. //X. campestris//, //X. hortorum//, //X. arboricola//, //X. fragariae//)
 === In other plant pathogens/symbionts ===
-Universally conserved protein.
+No
 ===== References =====
-Kara S (2016). Characterization of a new type three secretion effector in //Xanthomonas cynarae//. Doctoral Thesis. University of Florida, Gainesville, USA. PDF: [[https://ufdc.ufl.edu/UFE0050778/00001|ufdc.ufl.edu/UFE0050778/00001]]
+Teper D, Burstein D, Salomon D, Gershovitz M, Pupko T, Sessa G (2016). Identification of novel //Xanthomonas euvesicatoria// type III effector proteins by a machine-learning approach. Mol. Plant Pathol. 17: 398-411. DOI: [[https://doi.org/10.1111/mpp.12288|10.1111/mpp.12288]]
-Kara S, Timilsina S, Jacques MA, Potnis N, Vallad G, Fischer-Le Saux M, Hurlbert JC, Minsavage GV, Jones JB (2017). A novel type III Xop effector in //Xanthomonas cynarae// associated with rapid cell death. Phytopathology 107: S5.88. DOI: [[https://doi.org/10.1094/PHYTO-107-12-S5.1|10.1094/PHYTO-107-12-S5.1]]
+Yang L, Su H, Yang F, Jian H, Zhou M, Jiang W, Jiang B (2015). Identification of a new type III effector XC3176 in //Xanthomonas campestris// pv. //campestris//. Wei Sheng Wu Xue Bao 55: 1264-1272. PubMed ID: [[https://pubmed.ncbi.nlm.nih.gov/26939454/|26939454]]. Article in Chinese.

EuroXanth DokuWiki

User Tools

Site Tools

Differences

Page Tools