User Tools

Site Tools


bacteria:t3e:xopay

Differences

This shows you the differences between two versions of the page.

Link to this comparison view

Both sides previous revisionPrevious revision
Next revision
Previous revision
bacteria:t3e:xopay [2020/07/09 13:18] – [XopAY] rkoebnikbacteria:t3e:xopay [2025/07/04 23:21] (current) jfpothier
Line 1: Line 1:
-====== XopAY ======+====== The Type III Effector XopAY from //Xanthomonas// (replaced by XopAV) ======
  
-Author: John Doe\\ +Author: [[https://www.researchgate.net/profile/Ralf-Koebnik|Ralf Koebnik]]\\
-Reviewer: Jane Doe+
  
 Class: XopAY\\ Class: XopAY\\
 Family: XopAY\\ Family: XopAY\\
-Prototype: XC3176 (//Xanthomonas campestris// pv. //campestris//)\\ +Prototype: XC_3176 (//Xanthomonas campestris// pv. //campestris//; strain 8004)\\ 
-RefSeq ID:\\+GenBank ID: [[https://www.ncbi.nlm.nih.gov/protein/AAY50220.1|AAY50220.1]] (244 aa)\\
 3D structure: Unknown 3D structure: Unknown
  
Line 13: Line 12:
  
 === How discovered? === === How discovered? ===
 +
 +XopAY was originally assigned to [[https://www.ncbi.nlm.nih.gov/protein/AAY50220.1|XC_3176]], a protein that was identified as a type 3 effector (see below; Yang //et al.//, 2015). The N-terminal portion of [[https://www.ncbi.nlm.nih.gov/protein/AAY50220.1|XC_3176]] is similar to [[https://www.ncbi.nlm.nih.gov/protein/CAJ22828.1|XCV1197]] and the C-terminal portion is similar to [[https://www.ncbi.nlm.nih.gov/protein/CAJ22829.1|XCV1198]]. [[https://www.ncbi.nlm.nih.gov/protein/CAJ22828.1|XCV1197]] was shown to contain a type 3 secretion signal and was called [[:bacteria:t3e:xopav|XopAV]], now classified as XopAV1 (Teper //et al.//, 2016 ), whereas [[https://www.ncbi.nlm.nih.gov/protein/AAY50220.1|XC_3176]] was classified as XopAV2.
 +<code>
 +
 +XopAV1          ------------------------------------------------------------
 +XCV1197         MRREQCTKQCRRGRSCAGAACLGRWRGGIGAGCGGQRARSTRSPATLLVCLQRYVARACT
 +XCV1198         ------------------------------------------------------------
 +XC_3176         ------------------------------------------------------------
 +XopAV2          ------------------------------------------------------------
 +
 +XopAV1          -------------------------------MARIHSGEVTMRPLALTSVTRRGARREQQ
 +XCV1197         ACALWQAPCRLFRVRQWFFGRMRHARSRWGTMARIHSGEVTMRPLALTSVTRRGARREQQ
 +XCV1198         ------------------------------------------------------------
 +XC_3176         ----------------------------------------------MTSVAREAVRHDQR
 +XopAV2          -----------------------------------------MGSFPVTSVAREAVRHDQR
 +
 +XopAV1          EGATVADAGPPAPANDPHANTQLAQSLPRRPVREARLRAPGTPRGVPLVNLGRTMAHLGA
 +XCV1197         EGATVADAGPPAPANDPHANTQLAQSLPRRPTAISTMTCITRILL---------------
 +XCV1198         ------------------------------------------------------------
 +XC_3176         EAQAPREVGYSSQRGDPQANPQLKQDLSRAPVRAARLKAPRVPIGVHIANTGLQAARFAT
 +XopAV2          EAQAPREVGYSSQRGDPQANPQLKQDLSRAPVRAARLKAPRVPIGVHIANTGLQAARFAT
 +
 +XopAV1          ---VGAAVWGGFAAIQAPAAAAYGYFNDDLYYKNLAVVSGYQAVGALAAFLGMGLADVLA
 +XCV1197         ------------------------------------------------------------
 +XCV1198         -------------------------------------------MGALAAFLGMGLADVLA
 +XC_3176         SAVAGPAEAAVLDAVHAPAAAAYDYAKGEVSWKKNAGVTLAPALAYAVVMGTLSAVQYLA
 +XopAV2          SAVAGPAEAAVLDAVHAPAAAAYDYAKGEVSWKKNAGVTLAPALAYAVVMGTLSAVQYLA
 +
 +XopAV1          ARYVEAQSRWYEVPTKAQRASELGATEACLDQAVDMVTRLDADPPGPGMDEGERLALARD
 +XCV1197         ------------------------------------------------------------
 +XCV1198         ARYVEAQSRWYEVPTKAQRASELGATEACLDHAVDMVTIFDADHPGPAMDGGEQLVLATD
 +XC_3176         NRYLQAQSQ--TSVSKADRAKELGVTEACLDAAAAMVNKGEVAGPGGEMTEEEAAALAAD
 +XopAV2          NRYLQAQSQ--TSVSKADRAKELGVTEACLDAAAAMVNKGEVAGPGGEMTEEEAAALAAD
 +
 +XopAV1          LMHLMTVERSRLPPDLWRAARGAGNDAYGLVARLLQAARARAAEEASTSSAG
 +XCV1197         ----------------------------------------------------
 +XCV1198         LLHLMTVERSRLPPELWQAASGVGDDAHRLVTQLLQAARARAADEASTSSAD
 +XC_3176         LQNLATADRSRLPPELWRAASGVGDDAYALVTQLLLAARARASAEASASSDG
 +XopAV2          LQNLATADRSRLPPELWRAASGVGDDAYALVTQLLLAARARASAEASASSDG
 +
 +</code>
  
 === (Experimental) evidence for being a T3E === === (Experimental) evidence for being a T3E ===
 +
 +The promoter and signal region of XC_3176 were fused to the HR-inducing AvrBs1 C-terminal domain lack of 58 N-terminal amino acid residues. This construct elicited an hypersensitive response on the pepper ECW-10R containing the corresponding resistance gene //Bs1// in a //hrcV//-dependent manner (Yang et al., 2015).
  
 === Regulation === === Regulation ===
 +
 +A reporter GUS fusion of XC_3176 displayed GUS activities, which were significantly lower in the mutant strains Δ//hrpX// and Δ//hrpG// than that in the wild type //X. campestris// pv. //campestris// strain (Yang et al., 2015).
  
 === Phenotypes === === Phenotypes ===
 +
 +XC_3176 was found to be required for the full virulence of //X. campestris// pv. //campestris// strain 8004 when assayed on Chinese radish by the leaf-clipping method (Yang et al., 2015).
  
 === Localization === === Localization ===
 +
 +Unknown
  
 === Enzymatic function === === Enzymatic function ===
 +
 +Unknown
  
 === Interaction partners === === Interaction partners ===
 +
 +Unknown
  
 ===== Conservation ===== ===== Conservation =====
  
 === In xanthomonads === === In xanthomonads ===
 +
 +Yes (e.g. //X. campestris//, //X. hortorum//, //X. arboricola//, //X. fragariae//)
  
 === In other plant pathogens/symbionts === === In other plant pathogens/symbionts ===
 +
 +No
  
 ===== References ===== ===== References =====
  
-Yang L, Su H, Yang F, Jian H, Zhou M, Jiang W, Jiang B (2015). Identification of a new type III effector XC3176 in //Xanthomonas campestris// pv. //campestris//. Wei Sheng Wu Xue Bao 55: 1264-1272. Article in Chinese.+Teper D, Burstein D, Salomon D, Gershovitz M, Pupko T, Sessa G (2016). Identification of novel //Xanthomonas euvesicatoria// type III effector proteins by a machine-learning approach. Mol. Plant Pathol. 17: 398-411. DOI: [[https://doi.org/10.1111/mpp.12288|10.1111/mpp.12288]] 
 + 
 +Yang L, Su H, Yang F, Jian H, Zhou M, Jiang W, Jiang B (2015). Identification of a new type III effector XC3176 in //Xanthomonas campestris// pv. //campestris//. Wei Sheng Wu Xue Bao 55: 1264-1272. PubMed ID: [[https://pubmed.ncbi.nlm.nih.gov/26939454/|26939454]]. Article in Chinese.
  
bacteria/t3e/xopay.1594297126.txt.gz · Last modified: 2023/01/09 10:20 (external edit)